KIF2C monoclonal antibody (M01), clone 1G2 View larger

KIF2C monoclonal antibody (M01), clone 1G2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KIF2C monoclonal antibody (M01), clone 1G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Tr,IP,RNAi-Ab

More info about KIF2C monoclonal antibody (M01), clone 1G2

Brand: Abnova
Reference: H00011004-M01
Product name: KIF2C monoclonal antibody (M01), clone 1G2
Product description: Mouse monoclonal antibody raised against a partial recombinant KIF2C.
Clone: 1G2
Isotype: IgG1 kappa
Gene id: 11004
Gene name: KIF2C
Gene alias: KNSL6|MCAK
Gene description: kinesin family member 2C
Genbank accession: BC014924
Immunogen: KIF2C (AAH14924, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI
Protein accession: AAH14924
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011004-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011004-M01-3-27-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Tr,IP,RNAi-Ab
Shipping condition: Dry Ice
Publications: Mitotic Rounding Alters Cell Geometry to Ensure Efficient Bipolar Spindle Formation.Lancaster OM, Le Berre M, Dimitracopoulos A, Bonazzi D, Zlotek-Zlotkiewicz E, Picone R, Duke T, Piel M, Baum B
Dev Cell. 2013 May 13;25(3):270-83. doi: 10.1016/j.devcel.2013.03.014. Epub 2013 Apr 25.

Reviews

Buy KIF2C monoclonal antibody (M01), clone 1G2 now

Add to cart