SLC27A4 monoclonal antibody (M01), clone 1F4-1B10 View larger

SLC27A4 monoclonal antibody (M01), clone 1F4-1B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC27A4 monoclonal antibody (M01), clone 1F4-1B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SLC27A4 monoclonal antibody (M01), clone 1F4-1B10

Brand: Abnova
Reference: H00010999-M01
Product name: SLC27A4 monoclonal antibody (M01), clone 1F4-1B10
Product description: Mouse monoclonal antibody raised against a full length recombinant SLC27A4.
Clone: 1F4-1B10
Isotype: IgG1 kappa
Gene id: 10999
Gene name: SLC27A4
Gene alias: ACSVL4|FATP4
Gene description: solute carrier family 27 (fatty acid transporter), member 4
Genbank accession: BC009959
Immunogen: SLC27A4 (AAH09959.1, 1 a.a. ~ 237 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSGGGAAVLQAGAETALDPGGILPVVPLLGIWRLALHPGLHQDHQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
Protein accession: AAH09959.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010999-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (51.81 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010999-M01-1-1-1.jpg
Application image note: SLC27A4 monoclonal antibody (M01), clone 1F4-1B10 Western Blot analysis of SLC27A4 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Mutations in the Fatty Acid Transport Protein 4 Gene Cause the Ichthyosis Prematurity Syndrome.Klar J, Schweiger M, Zimmerman R, Zechner R, Li H, Torma H, Vahlquist A, Bouadjar B, Dahl N, Fischer J.
Am J Hum Genet. 2009 Aug;85(2):248-53. Epub 2009 Jul 23.

Reviews

Buy SLC27A4 monoclonal antibody (M01), clone 1F4-1B10 now

Add to cart