Brand: | Abnova |
Reference: | H00010998-M01 |
Product name: | SLC27A5 monoclonal antibody (M01), clone 5A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC27A5. |
Clone: | 5A7 |
Isotype: | IgG2a Kappa |
Gene id: | 10998 |
Gene name: | SLC27A5 |
Gene alias: | ACSB|ACSVL6|FACVL3|FATP5|FLJ22987|VLACSR|VLCS-H2|VLCSH2 |
Gene description: | solute carrier family 27 (fatty acid transporter), member 5 |
Genbank accession: | NM_012254 |
Immunogen: | SLC27A5 (NP_036386, 90 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DVIFLAKILHLGLKIRGCLSRQPPDTFVDAFERRARAQPGRALLVWTGPGAGSVTFGELDARACQAAWALKAELGDPASLCAGEPT |
Protein accession: | NP_036386 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.2 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC27A5 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |