SLC27A5 monoclonal antibody (M01), clone 5A7 View larger

SLC27A5 monoclonal antibody (M01), clone 5A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC27A5 monoclonal antibody (M01), clone 5A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SLC27A5 monoclonal antibody (M01), clone 5A7

Brand: Abnova
Reference: H00010998-M01
Product name: SLC27A5 monoclonal antibody (M01), clone 5A7
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC27A5.
Clone: 5A7
Isotype: IgG2a Kappa
Gene id: 10998
Gene name: SLC27A5
Gene alias: ACSB|ACSVL6|FACVL3|FATP5|FLJ22987|VLACSR|VLCS-H2|VLCSH2
Gene description: solute carrier family 27 (fatty acid transporter), member 5
Genbank accession: NM_012254
Immunogen: SLC27A5 (NP_036386, 90 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DVIFLAKILHLGLKIRGCLSRQPPDTFVDAFERRARAQPGRALLVWTGPGAGSVTFGELDARACQAAWALKAELGDPASLCAGEPT
Protein accession: NP_036386
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010998-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010998-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC27A5 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SLC27A5 monoclonal antibody (M01), clone 5A7 now

Add to cart