SDS monoclonal antibody (M03), clone 1A9 View larger

SDS monoclonal antibody (M03), clone 1A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SDS monoclonal antibody (M03), clone 1A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SDS monoclonal antibody (M03), clone 1A9

Brand: Abnova
Reference: H00010993-M03
Product name: SDS monoclonal antibody (M03), clone 1A9
Product description: Mouse monoclonal antibody raised against a full-length recombinant SDS.
Clone: 1A9
Isotype: IgG2b Kappa
Gene id: 10993
Gene name: SDS
Gene alias: SDH
Gene description: serine dehydratase
Genbank accession: BC020750
Immunogen: SDS (AAH20750, 1 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITR
Protein accession: AAH20750
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010993-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49.72 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010993-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SDS is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SDS monoclonal antibody (M03), clone 1A9 now

Add to cart