Brand: | Abnova |
Reference: | H00010992-M01 |
Product name: | SF3B2 monoclonal antibody (M01), clone 5D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SF3B2. |
Clone: | 5D2 |
Isotype: | IgG2a Kappa |
Gene id: | 10992 |
Gene name: | SF3B2 |
Gene alias: | SAP145|SF3B145|SF3b1|SF3b150 |
Gene description: | splicing factor 3b, subunit 2, 145kDa |
Genbank accession: | NM_006842 |
Immunogen: | SF3B2 (NP_006833, 592 a.a. ~ 645 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY |
Protein accession: | NP_006833 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.68 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to SF3B2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 6 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |