SF3B2 monoclonal antibody (M01), clone 5D2 View larger

SF3B2 monoclonal antibody (M01), clone 5D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SF3B2 monoclonal antibody (M01), clone 5D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,ELISA,WB-Re

More info about SF3B2 monoclonal antibody (M01), clone 5D2

Brand: Abnova
Reference: H00010992-M01
Product name: SF3B2 monoclonal antibody (M01), clone 5D2
Product description: Mouse monoclonal antibody raised against a partial recombinant SF3B2.
Clone: 5D2
Isotype: IgG2a Kappa
Gene id: 10992
Gene name: SF3B2
Gene alias: SAP145|SF3B145|SF3b1|SF3b150
Gene description: splicing factor 3b, subunit 2, 145kDa
Genbank accession: NM_006842
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 645 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY
Protein accession: NP_006833
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010992-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.68 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00010992-M01-3-2-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SF3B2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 6 ug/ml]
Applications: WB-Ce,IHC-P,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SF3B2 monoclonal antibody (M01), clone 5D2 now

Add to cart