Brand: | Abnova |
Reference: | H00010989-A01 |
Product name: | IMMT polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant IMMT. |
Gene id: | 10989 |
Gene name: | IMMT |
Gene alias: | DKFZp779P1653|HMP|MGC111146|P87|P87/89|P89|PIG4|PIG52 |
Gene description: | inner membrane protein, mitochondrial (mitofilin) |
Genbank accession: | NM_006839 |
Immunogen: | IMMT (NP_006830, 481 a.a. ~ 580 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSM |
Protein accession: | NP_006830 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00010989-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00010989-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00010989-A01-1-4-1.jpg](http://www.abnova.com/application_image/H00010989-A01-1-4-1.jpg) |
Application image note: | IMMT polyclonal antibody (A01), Lot # 060503JCS1 Western Blot analysis of IMMT expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |