MAPRE2 monoclonal antibody (M03), clone 4D7 View larger

MAPRE2 monoclonal antibody (M03), clone 4D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAPRE2 monoclonal antibody (M03), clone 4D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr

More info about MAPRE2 monoclonal antibody (M03), clone 4D7

Brand: Abnova
Reference: H00010982-M03
Product name: MAPRE2 monoclonal antibody (M03), clone 4D7
Product description: Mouse monoclonal antibody raised against a partial recombinant MAPRE2.
Clone: 4D7
Isotype: IgG1 Kappa
Gene id: 10982
Gene name: MAPRE2
Gene alias: EB1|EB2|RP1
Gene description: microtubule-associated protein, RP/EB family, member 2
Genbank accession: NM_014268
Immunogen: MAPRE2 (NP_055083, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHD
Protein accession: NP_055083
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010982-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.93 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010982-M03-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to MAPRE2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MAPRE2 monoclonal antibody (M03), clone 4D7 now

Add to cart