Brand: | Abnova |
Reference: | H00010982-M03 |
Product name: | MAPRE2 monoclonal antibody (M03), clone 4D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPRE2. |
Clone: | 4D7 |
Isotype: | IgG1 Kappa |
Gene id: | 10982 |
Gene name: | MAPRE2 |
Gene alias: | EB1|EB2|RP1 |
Gene description: | microtubule-associated protein, RP/EB family, member 2 |
Genbank accession: | NM_014268 |
Immunogen: | MAPRE2 (NP_055083, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHD |
Protein accession: | NP_055083 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.93 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to MAPRE2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |