RAB32 purified MaxPab rabbit polyclonal antibody (D01P) View larger

RAB32 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB32 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about RAB32 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00010981-D01P
Product name: RAB32 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human RAB32 protein.
Gene id: 10981
Gene name: RAB32
Gene alias: -
Gene description: RAB32, member RAS oncogene family
Genbank accession: NM_006834.1
Immunogen: RAB32 (NP_006825.1, 1 a.a. ~ 225 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
Protein accession: NP_006825
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00010981-D01P-2-A1-1.jpg
Application image note: RAB32 MaxPab rabbit polyclonal antibody. Western Blot analysis of RAB32 expression in human liver.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAB32 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart