RAB32 purified MaxPab mouse polyclonal antibody (B02P) View larger

RAB32 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB32 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RAB32 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00010981-B02P
Product name: RAB32 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human RAB32 protein.
Gene id: 10981
Gene name: RAB32
Gene alias: -
Gene description: RAB32, member RAS oncogene family
Genbank accession: NM_006834
Immunogen: RAB32 (NP_006825, 1 a.a. ~ 225 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
Protein accession: NP_006825
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010981-B02P-13-15-1.jpg
Application image note: Western Blot analysis of RAB32 expression in transfected 293T cell line (H00010981-T02) by RAB32 MaxPab polyclonal antibody.

Lane 1: RAB32 transfected lysate(24.75 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAB32 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart