HEAB monoclonal antibody (M01), clone 8D5 View larger

HEAB monoclonal antibody (M01), clone 8D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HEAB monoclonal antibody (M01), clone 8D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about HEAB monoclonal antibody (M01), clone 8D5

Brand: Abnova
Reference: H00010978-M01
Product name: HEAB monoclonal antibody (M01), clone 8D5
Product description: Mouse monoclonal antibody raised against a partial recombinant HEAB.
Clone: 8D5
Isotype: IgG2a Kappa
Gene id: 10978
Gene name: CLP1
Gene alias: HEAB|hClp1
Gene description: CLP1, cleavage and polyadenylation factor I subunit, homolog (S. cerevisiae)
Genbank accession: NM_006831
Immunogen: HEAB (NP_006822, 316 a.a. ~ 425 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLSPAPRPLPKNFLLIMDIRFMDLK
Protein accession: NP_006822
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010978-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010978-M01-13-15-1.jpg
Application image note: Western Blot analysis of HEAB expression in transfected 293T cell line by HEAB monoclonal antibody (M01), clone 8D5.

Lane 1: HEAB transfected lysate(47.946 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HEAB monoclonal antibody (M01), clone 8D5 now

Add to cart