RAB40B monoclonal antibody (M01A), clone 1A1 View larger

RAB40B monoclonal antibody (M01A), clone 1A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB40B monoclonal antibody (M01A), clone 1A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about RAB40B monoclonal antibody (M01A), clone 1A1

Brand: Abnova
Reference: H00010966-M01A
Product name: RAB40B monoclonal antibody (M01A), clone 1A1
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB40B.
Clone: 1A1
Isotype: IgG1 Kappa
Gene id: 10966
Gene name: RAB40B
Gene alias: FLJ42385|RAR|SEC4L
Gene description: RAB40B, member RAS oncogene family
Genbank accession: BC018039
Immunogen: RAB40B (AAH18039, 179 a.a. ~ 278 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS
Protein accession: AAH18039
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy RAB40B monoclonal antibody (M01A), clone 1A1 now

Add to cart