Brand: | Abnova |
Reference: | H00010966-M01A |
Product name: | RAB40B monoclonal antibody (M01A), clone 1A1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB40B. |
Clone: | 1A1 |
Isotype: | IgG1 Kappa |
Gene id: | 10966 |
Gene name: | RAB40B |
Gene alias: | FLJ42385|RAR|SEC4L |
Gene description: | RAB40B, member RAS oncogene family |
Genbank accession: | BC018039 |
Immunogen: | RAB40B (AAH18039, 179 a.a. ~ 278 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS |
Protein accession: | AAH18039 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |