STIP1 (Human) Recombinant Protein (Q03) View larger

STIP1 (Human) Recombinant Protein (Q03)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STIP1 (Human) Recombinant Protein (Q03)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about STIP1 (Human) Recombinant Protein (Q03)

Brand: Abnova
Reference: H00010963-Q03
Product name: STIP1 (Human) Recombinant Protein (Q03)
Product description: Human STIP1 partial ORF ( AAH02987.1, 80 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 10963
Gene name: STIP1
Gene alias: HOP|IEF-SSP-3521|P60|STI1|STI1L
Gene description: stress-induced-phosphoprotein 1
Genbank accession: BC002987
Immunogen sequence/protein sequence: AALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLS
Protein accession: AAH02987.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00010963-Q03-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy STIP1 (Human) Recombinant Protein (Q03) now

Add to cart