STIP1 monoclonal antibody (M02), clone 1B10 View larger

STIP1 monoclonal antibody (M02), clone 1B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STIP1 monoclonal antibody (M02), clone 1B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about STIP1 monoclonal antibody (M02), clone 1B10

Brand: Abnova
Reference: H00010963-M02
Product name: STIP1 monoclonal antibody (M02), clone 1B10
Product description: Mouse monoclonal antibody raised against a partial recombinant STIP1.
Clone: 1B10
Isotype: IgG2a Kappa
Gene id: 10963
Gene name: STIP1
Gene alias: HOP|IEF-SSP-3521|P60|STI1|STI1L
Gene description: stress-induced-phosphoprotein 1
Genbank accession: NM_006819
Immunogen: STIP1 (NP_006810.1, 445 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR
Protein accession: NP_006810.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010963-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00010963-M02-1-6-1.jpg
Application image note: STIP1 monoclonal antibody (M02), clone 1B10. Western Blot analysis of STIP1 expression in Jurkat.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy STIP1 monoclonal antibody (M02), clone 1B10 now

Add to cart