Brand: | Abnova |
Reference: | H00010963-M02 |
Product name: | STIP1 monoclonal antibody (M02), clone 1B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STIP1. |
Clone: | 1B10 |
Isotype: | IgG2a Kappa |
Gene id: | 10963 |
Gene name: | STIP1 |
Gene alias: | HOP|IEF-SSP-3521|P60|STI1|STI1L |
Gene description: | stress-induced-phosphoprotein 1 |
Genbank accession: | NM_006819 |
Immunogen: | STIP1 (NP_006810.1, 445 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR |
Protein accession: | NP_006810.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | STIP1 monoclonal antibody (M02), clone 1B10. Western Blot analysis of STIP1 expression in Jurkat. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |