Brand: | Abnova |
Reference: | H00010962-M01 |
Product name: | AF1Q monoclonal antibody (M01), clone 2A9-1B7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant AF1Q. |
Clone: | 2A9-1B7 |
Isotype: | IgG2a kappa |
Gene id: | 10962 |
Gene name: | MLLT11 |
Gene alias: | AF1Q|RP11-316M1.10 |
Gene description: | myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 |
Genbank accession: | BC009624 |
Immunogen: | AF1Q (AAH09624, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL |
Protein accession: | AAH09624 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MLLT11 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | AF1q: A Novel Mediator of Basal and 4-HPR-Induced Apoptosis in Ovarian Cancer Cells.Tiberio P, Cavadini E, Callari M, Daidone MG, Appierto V. PLoS One. 2012;7(6):e39968. Epub 2012 Jun 26. |