AF1Q monoclonal antibody (M01), clone 2A9-1B7 View larger

AF1Q monoclonal antibody (M01), clone 2A9-1B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AF1Q monoclonal antibody (M01), clone 2A9-1B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about AF1Q monoclonal antibody (M01), clone 2A9-1B7

Brand: Abnova
Reference: H00010962-M01
Product name: AF1Q monoclonal antibody (M01), clone 2A9-1B7
Product description: Mouse monoclonal antibody raised against a full length recombinant AF1Q.
Clone: 2A9-1B7
Isotype: IgG2a kappa
Gene id: 10962
Gene name: MLLT11
Gene alias: AF1Q|RP11-316M1.10
Gene description: myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11
Genbank accession: BC009624
Immunogen: AF1Q (AAH09624, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL
Protein accession: AAH09624
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010962-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010962-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged MLLT11 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: AF1q: A Novel Mediator of Basal and 4-HPR-Induced Apoptosis in Ovarian Cancer Cells.Tiberio P, Cavadini E, Callari M, Daidone MG, Appierto V.
PLoS One. 2012;7(6):e39968. Epub 2012 Jun 26.

Reviews

Buy AF1Q monoclonal antibody (M01), clone 2A9-1B7 now

Add to cart