TOMM34 monoclonal antibody (M02), clone 1D2 View larger

TOMM34 monoclonal antibody (M02), clone 1D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TOMM34 monoclonal antibody (M02), clone 1D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr,IP

More info about TOMM34 monoclonal antibody (M02), clone 1D2

Brand: Abnova
Reference: H00010953-M02
Product name: TOMM34 monoclonal antibody (M02), clone 1D2
Product description: Mouse monoclonal antibody raised against a full-length recombinant TOMM34.
Clone: 1D2
Isotype: IgG2a Kappa
Gene id: 10953
Gene name: TOMM34
Gene alias: HTOM34P|TOM34|URCC3
Gene description: translocase of outer mitochondrial membrane 34
Genbank accession: BC001763
Immunogen: TOMM34 (AAH01763, 1 a.a. ~ 309 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH
Protein accession: AAH01763
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010953-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (59.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010953-M02-13-15-1.jpg
Application image note: Western Blot analysis of TOMM34 expression in transfected 293T cell line by TOMM34 monoclonal antibody (M02), clone 1D2.

Lane 1: TOMM34 transfected lysate(34.6 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy TOMM34 monoclonal antibody (M02), clone 1D2 now

Add to cart