TOMM34 monoclonal antibody (M01), clone 2B5 View larger

TOMM34 monoclonal antibody (M01), clone 2B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TOMM34 monoclonal antibody (M01), clone 2B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about TOMM34 monoclonal antibody (M01), clone 2B5

Brand: Abnova
Reference: H00010953-M01
Product name: TOMM34 monoclonal antibody (M01), clone 2B5
Product description: Mouse monoclonal antibody raised against a full length recombinant TOMM34.
Clone: 2B5
Isotype: IgG2a Kappa
Gene id: 10953
Gene name: TOMM34
Gene alias: HTOM34P|TOM34|URCC3
Gene description: translocase of outer mitochondrial membrane 34
Genbank accession: BC001763
Immunogen: TOMM34 (AAH01763, 1 a.a. ~ 309 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH
Protein accession: AAH01763
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010953-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (59.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010953-M01-1-1-1.jpg
Application image note: TOMM34 monoclonal antibody (M01), clone 2B5 Western Blot analysis of TOMM34 expression in Hela ( Cat # L013V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TOMM34 monoclonal antibody (M01), clone 2B5 now

Add to cart