Brand: | Abnova |
Reference: | H00010953-M01 |
Product name: | TOMM34 monoclonal antibody (M01), clone 2B5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TOMM34. |
Clone: | 2B5 |
Isotype: | IgG2a Kappa |
Gene id: | 10953 |
Gene name: | TOMM34 |
Gene alias: | HTOM34P|TOM34|URCC3 |
Gene description: | translocase of outer mitochondrial membrane 34 |
Genbank accession: | BC001763 |
Immunogen: | TOMM34 (AAH01763, 1 a.a. ~ 309 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH |
Protein accession: | AAH01763 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (59.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TOMM34 monoclonal antibody (M01), clone 2B5 Western Blot analysis of TOMM34 expression in Hela ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |