TOMM34 purified MaxPab mouse polyclonal antibody (B01P) View larger

TOMM34 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TOMM34 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about TOMM34 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00010953-B01P
Product name: TOMM34 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TOMM34 protein.
Gene id: 10953
Gene name: TOMM34
Gene alias: HTOM34P|TOM34|URCC3
Gene description: translocase of outer mitochondrial membrane 34
Genbank accession: NM_006809.4
Immunogen: TOMM34 (NP_006800.2, 1 a.a. ~ 309 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH
Protein accession: NP_006800.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010953-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TOMM34 expression in transfected 293T cell line (H00010953-T01) by TOMM34 MaxPab polyclonal antibody.

Lane 1: TOMM34 transfected lysate(33.99 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TOMM34 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart