CBX1 monoclonal antibody (M01), clone 4E12 View larger

CBX1 monoclonal antibody (M01), clone 4E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CBX1 monoclonal antibody (M01), clone 4E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CBX1 monoclonal antibody (M01), clone 4E12

Brand: Abnova
Reference: H00010951-M01
Product name: CBX1 monoclonal antibody (M01), clone 4E12
Product description: Mouse monoclonal antibody raised against a partial recombinant CBX1.
Clone: 4E12
Isotype: IgG2a Kappa
Gene id: 10951
Gene name: CBX1
Gene alias: CBX|HP1-BETA|HP1Hs-beta|HP1Hsbeta|M31|MOD1|p25beta
Gene description: chromobox homolog 1 (HP1 beta homolog Drosophila )
Genbank accession: NM_006807
Immunogen: CBX1 (NP_006798.1, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESK
Protein accession: NP_006798.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010951-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010951-M01-13-15-1.jpg
Application image note: Western Blot analysis of CBX1 expression in transfected 293T cell line by CBX1 monoclonal antibody (M01), clone 4E12.

Lane 1: CBX1 transfected lysate(21.4 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CBX1 monoclonal antibody (M01), clone 4E12 now

Add to cart