Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010951-M01 |
Product name: | CBX1 monoclonal antibody (M01), clone 4E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CBX1. |
Clone: | 4E12 |
Isotype: | IgG2a Kappa |
Gene id: | 10951 |
Gene name: | CBX1 |
Gene alias: | CBX|HP1-BETA|HP1Hs-beta|HP1Hsbeta|M31|MOD1|p25beta |
Gene description: | chromobox homolog 1 (HP1 beta homolog Drosophila ) |
Genbank accession: | NM_006807 |
Immunogen: | CBX1 (NP_006798.1, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESK |
Protein accession: | NP_006798.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CBX1 expression in transfected 293T cell line by CBX1 monoclonal antibody (M01), clone 4E12. Lane 1: CBX1 transfected lysate(21.4 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |