Brand: | Abnova |
Reference: | H00010942-M01 |
Product name: | PRSS21 monoclonal antibody (M01), clone 2E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRSS21. |
Clone: | 2E10 |
Isotype: | IgG1 Kappa |
Gene id: | 10942 |
Gene name: | PRSS21 |
Gene alias: | ESP-1|ESP1|TEST1|TESTISIN |
Gene description: | protease, serine, 21 (testisin) |
Genbank accession: | NM_006799 |
Immunogen: | PRSS21 (NP_006790, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGD |
Protein accession: | NP_006790 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of PRSS21 transfected lysate using anti-PRSS21 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PRSS21 MaxPab rabbit polyclonal antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |