Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRSS21 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about PRSS21 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00010942-B01P |
| Product name: | PRSS21 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PRSS21 protein. |
| Gene id: | 10942 |
| Gene name: | PRSS21 |
| Gene alias: | ESP-1|ESP1|TEST1|TESTISIN |
| Gene description: | protease, serine, 21 (testisin) |
| Genbank accession: | NM_006799.2 |
| Immunogen: | PRSS21 (NP_006790.1, 1 a.a. ~ 314 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGARGALLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQSGMSQPDPSWPLLFFPLLWALPLLGPV |
| Protein accession: | NP_006790.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PRSS21 expression in transfected 293T cell line (H00010942-T01) by PRSS21 MaxPab polyclonal antibody. Lane 1: PRSS21 transfected lysate(34.54 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Interaction of testisin with maspin and its impact on invasion and cell death resistance of cervical cancer cells.Yeom SY, Jang HL, Lee SJ, Kim E, Son HJ, Kim BG, Park C. FEBS Lett. 2010 Mar 6. [Epub ahead of print] |