MORF4L1 monoclonal antibody (M01), clone 6B6 View larger

MORF4L1 monoclonal antibody (M01), clone 6B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MORF4L1 monoclonal antibody (M01), clone 6B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about MORF4L1 monoclonal antibody (M01), clone 6B6

Brand: Abnova
Reference: H00010933-M01
Product name: MORF4L1 monoclonal antibody (M01), clone 6B6
Product description: Mouse monoclonal antibody raised against a partial recombinant MORF4L1.
Clone: 6B6
Isotype: IgG2a Kappa
Gene id: 10933
Gene name: MORF4L1
Gene alias: Eaf3|FWP006|HsT17725|MGC10631|MORFRG15|MRG15|S863-6
Gene description: mortality factor 4 like 1
Genbank accession: NM_006791
Immunogen: MORF4L1 (NP_006782.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG
Protein accession: NP_006782.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010933-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010933-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MORF4L1 is 0.1 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MORF4L1 monoclonal antibody (M01), clone 6B6 now

Add to cart