APOBEC2 monoclonal antibody (M01), clone 4D7 View larger

APOBEC2 monoclonal antibody (M01), clone 4D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOBEC2 monoclonal antibody (M01), clone 4D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about APOBEC2 monoclonal antibody (M01), clone 4D7

Brand: Abnova
Reference: H00010930-M01
Product name: APOBEC2 monoclonal antibody (M01), clone 4D7
Product description: Mouse monoclonal antibody raised against a full-length recombinant APOBEC2.
Clone: 4D7
Isotype: IgG2a Kappa
Gene id: 10930
Gene name: APOBEC2
Gene alias: ARCD1|ARP1
Gene description: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2
Genbank accession: NM_006789.2
Immunogen: APOBEC2 (NP_006780.1, 1 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK
Protein accession: NP_006780.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010930-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (52.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010930-M01-13-15-1.jpg
Application image note: Western Blot analysis of APOBEC2 expression in transfected 293T cell line by APOBEC2 monoclonal antibody (M01), clone 4D7.

Lane 1: APOBEC2 transfected lysate (Predicted MW: 25.7 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy APOBEC2 monoclonal antibody (M01), clone 4D7 now

Add to cart