Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010930-M01 |
Product name: | APOBEC2 monoclonal antibody (M01), clone 4D7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant APOBEC2. |
Clone: | 4D7 |
Isotype: | IgG2a Kappa |
Gene id: | 10930 |
Gene name: | APOBEC2 |
Gene alias: | ARCD1|ARP1 |
Gene description: | apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 |
Genbank accession: | NM_006789.2 |
Immunogen: | APOBEC2 (NP_006780.1, 1 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK |
Protein accession: | NP_006780.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (52.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of APOBEC2 expression in transfected 293T cell line by APOBEC2 monoclonal antibody (M01), clone 4D7. Lane 1: APOBEC2 transfected lysate (Predicted MW: 25.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |