Brand: | Abnova |
Reference: | H00010923-M11 |
Product name: | SUB1 monoclonal antibody (M11), clone 3A1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SUB1. |
Clone: | 3A1 |
Isotype: | IgG2a Kappa |
Gene id: | 10923 |
Gene name: | SUB1 |
Gene alias: | MGC102747|P15|PC4|p14 |
Gene description: | SUB1 homolog (S. cerevisiae) |
Genbank accession: | BC009610 |
Immunogen: | SUB1 (AAH09610.1, 32 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | APEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAV |
Protein accession: | AAH09610.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SUB1 monoclonal antibody (M11), clone 3A1. Western Blot analysis of SUB1 expression in IMR-32. |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |