SUB1 purified MaxPab mouse polyclonal antibody (B01P) View larger

SUB1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUB1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about SUB1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00010923-B01P
Product name: SUB1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SUB1 protein.
Gene id: 10923
Gene name: SUB1
Gene alias: MGC102747|P15|PC4|p14
Gene description: SUB1 homolog (S. cerevisiae)
Genbank accession: BC010537
Immunogen: SUB1 (AAH10537, 1 a.a. ~ 127 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPKSKELVSSSSSGSDSDSEVDKELKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
Protein accession: AAH10537
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010923-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SUB1 expression in transfected 293T cell line (H00010923-T01) by SUB1 MaxPab polyclonal antibody.

Lane 1: SUB1 transfected lysate(14.08 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SUB1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart