FASTK monoclonal antibody (M02), clone 2B7 View larger

FASTK monoclonal antibody (M02), clone 2B7

H00010922-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FASTK monoclonal antibody (M02), clone 2B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr

More info about FASTK monoclonal antibody (M02), clone 2B7

Brand: Abnova
Reference: H00010922-M02
Product name: FASTK monoclonal antibody (M02), clone 2B7
Product description: Mouse monoclonal antibody raised against a partial recombinant FASTK.
Clone: 2B7
Isotype: IgG2a Kappa
Gene id: 10922
Gene name: FASTK
Gene alias: FAST
Gene description: Fas-activated serine/threonine kinase
Genbank accession: NM_006712
Immunogen: FASTK (NP_006703, 67 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KWGDRPVGGGPSAGPVQGLQRLLEQAKSPGELLRWLGQNPSKVRAHHYSVALRRLGQLLGSRPRPPPVEQVTLQDLSQLIIRNCPSFD
Protein accession: NP_006703
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010922-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010922-M02-13-15-1.jpg
Application image note: Western Blot analysis of FASTK expression in transfected 293T cell line by FASTK monoclonal antibody (M02), clone 2B7.

Lane 1: FASTK transfected lysate(61.104 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FASTK monoclonal antibody (M02), clone 2B7 now

Add to cart