Brand: | Abnova |
Reference: | H00010921-M05 |
Product name: | RNPS1 monoclonal antibody (M05), clone 7G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNPS1. |
Clone: | 7G8 |
Isotype: | IgG2a Kappa |
Gene id: | 10921 |
Gene name: | RNPS1 |
Gene alias: | E5.1|MGC117332 |
Gene description: | RNA binding protein S1, serine-rich domain |
Genbank accession: | NM_006711 |
Immunogen: | RNPS1 (NP_006702, 158 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL |
Protein accession: | NP_006702 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in HeLa. |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.Huang Y, Jeong JS, Okamura J, Sook-Kim M, Zhu H, Guerrero-Preston R, Ratovitski EA Cell Cycle. 2012 Jun 15;11(12):2367-79. doi: 10.4161/cc.20863. Epub 2012 Jun 15. |