RNPS1 monoclonal antibody (M05), clone 7G8 View larger

RNPS1 monoclonal antibody (M05), clone 7G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNPS1 monoclonal antibody (M05), clone 7G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,ELISA,WB-Re

More info about RNPS1 monoclonal antibody (M05), clone 7G8

Brand: Abnova
Reference: H00010921-M05
Product name: RNPS1 monoclonal antibody (M05), clone 7G8
Product description: Mouse monoclonal antibody raised against a partial recombinant RNPS1.
Clone: 7G8
Isotype: IgG2a Kappa
Gene id: 10921
Gene name: RNPS1
Gene alias: E5.1|MGC117332
Gene description: RNA binding protein S1, serine-rich domain
Genbank accession: NM_006711
Immunogen: RNPS1 (NP_006702, 158 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL
Protein accession: NP_006702
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010921-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.76 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00010921-M05-1-1-1.jpg
Application image note: RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in HeLa.
Applications: WB-Ce,WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.Huang Y, Jeong JS, Okamura J, Sook-Kim M, Zhu H, Guerrero-Preston R, Ratovitski EA
Cell Cycle. 2012 Jun 15;11(12):2367-79. doi: 10.4161/cc.20863. Epub 2012 Jun 15.

Reviews

Buy RNPS1 monoclonal antibody (M05), clone 7G8 now

Add to cart