Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010920-M04 |
Product name: | COPS8 monoclonal antibody (M04), clone 2G8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant COPS8. |
Clone: | 2G8 |
Isotype: | IgG2a Kappa |
Gene id: | 10920 |
Gene name: | COPS8 |
Gene alias: | COP9|CSN8|MGC1297|MGC43256|SGN8 |
Gene description: | COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) |
Genbank accession: | BC003090 |
Immunogen: | COPS8 (AAH03090, 1 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN |
Protein accession: | AAH03090 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (48.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of COPS8 expression in transfected 293T cell line by COPS8 monoclonal antibody (M04), clone 2G8. Lane 1: COPS8 transfected lysate(23.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |