EDAR monoclonal antibody (M01), clone 6C12 View larger

EDAR monoclonal antibody (M01), clone 6C12

H00010913-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EDAR monoclonal antibody (M01), clone 6C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about EDAR monoclonal antibody (M01), clone 6C12

Brand: Abnova
Reference: H00010913-M01
Product name: EDAR monoclonal antibody (M01), clone 6C12
Product description: Mouse monoclonal antibody raised against a partial recombinant EDAR.
Clone: 6C12
Isotype: IgG2b Kappa
Gene id: 10913
Gene name: EDAR
Gene alias: DL|ED1R|ED3|ED5|EDA-A1R|EDA1R|EDA3|FLJ94390
Gene description: ectodysplasin A receptor
Genbank accession: NM_022336
Immunogen: EDAR (NP_071731, 64 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL
Protein accession: NP_071731
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010913-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.39 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010913-M01-2-A0-1.jpg
Application image note: EDAR monoclonal antibody (M01), clone 6C12. Western Blot analysis of EDAR expression in human kidney.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EDAR monoclonal antibody (M01), clone 6C12 now

Add to cart