Brand: | Abnova |
Reference: | H00010912-M02 |
Product name: | GADD45G monoclonal antibody (M02), clone 1G10 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant GADD45G. |
Clone: | 1G10 |
Isotype: | IgG2a Kappa |
Gene id: | 10912 |
Gene name: | GADD45G |
Gene alias: | CR6|DDIT2|GADD45gamma|GRP17 |
Gene description: | growth arrest and DNA-damage-inducible, gamma |
Genbank accession: | BC019325 |
Immunogen: | GADD45G (AAH19325, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE |
Protein accession: | AAH19325 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.23 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GADD45G is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |