SUGT1 purified MaxPab mouse polyclonal antibody (B01P) View larger

SUGT1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUGT1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about SUGT1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00010910-B01P
Product name: SUGT1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SUGT1 protein.
Gene id: 10910
Gene name: SUGT1
Gene alias: SGT1
Gene description: SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
Genbank accession: NM_006704
Immunogen: SUGT1 (NP_006695.1, 1 a.a. ~ 333 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
Protein accession: NP_006695.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010910-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SUGT1 expression in transfected 293T cell line (H00010910-T01) by SUGT1 MaxPab polyclonal antibody.

Lane 1: SUGT1 transfected lysate(36.63 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SUGT1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart