Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00010901-B01P |
Product name: | DHRS4 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human DHRS4 protein. |
Gene id: | 10901 |
Gene name: | DHRS4 |
Gene alias: | DHRS4L2|FLJ11008|NRDR|SCAD-SRL|SDR-SRL|SDR25C1|humNRDR |
Gene description: | dehydrogenase/reductase (SDR family) member 4 |
Genbank accession: | NM_021004.2 |
Immunogen: | DHRS4 (NP_066284.2, 1 a.a. ~ 278 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL |
Protein accession: | NP_066284.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of DHRS4 expression in transfected 293T cell line (H00010901-T01) by DHRS4 MaxPab polyclonal antibody. Lane 1: DHRS4 transfected lysate(30.58 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |