PPARGC1A polyclonal antibody (A01) View larger

PPARGC1A polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPARGC1A polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PPARGC1A polyclonal antibody (A01)

Brand: Abnova
Reference: H00010891-A01
Product name: PPARGC1A polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PPARGC1A.
Gene id: 10891
Gene name: PPARGC1A
Gene alias: LEM6|PGC-1(alpha)|PGC-1v|PGC1|PGC1A|PPARGC1
Gene description: peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Genbank accession: NM_013261
Immunogen: PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Protein accession: NP_037393
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010891-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PPARGC1A polyclonal antibody (A01) now

Add to cart