PPP1R13L polyclonal antibody (A01) View larger

PPP1R13L polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP1R13L polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PPP1R13L polyclonal antibody (A01)

Brand: Abnova
Reference: H00010848-A01
Product name: PPP1R13L polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PPP1R13L.
Gene id: 10848
Gene name: PPP1R13L
Gene alias: IASPP|NKIP1|RAI
Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 13 like
Genbank accession: NM_006663
Immunogen: PPP1R13L (NP_006654, 253 a.a. ~ 351 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: AFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV
Protein accession: NP_006654
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010848-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PPP1R13L polyclonal antibody (A01) now

Add to cart