Brand: | Abnova |
Reference: | H00010846-M02 |
Product name: | PDE10A monoclonal antibody (M02), clone 4E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PDE10A. |
Clone: | 4E1 |
Isotype: | IgG1 Kappa |
Gene id: | 10846 |
Gene name: | PDE10A |
Gene alias: | FLJ11894|FLJ25677|HSPDE10A |
Gene description: | phosphodiesterase 10A |
Genbank accession: | NM_006661 |
Immunogen: | PDE10A (NP_006652, 242 a.a. ~ 333 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQ |
Protein accession: | NP_006652 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PDE10A is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |