Brand: | Abnova |
Reference: | H00010842-M01 |
Product name: | C7orf16 monoclonal antibody (M01), clone 3E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant C7orf16. |
Clone: | 3E6 |
Isotype: | IgG2a Kappa |
Gene id: | 10842 |
Gene name: | C7orf16 |
Gene alias: | GSBS |
Gene description: | chromosome 7 open reading frame 16 |
Genbank accession: | NM_006658 |
Immunogen: | C7orf16 (NP_006649, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMSTEQMQPLELSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGK |
Protein accession: | NP_006649 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged C7orf16 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |