Brand: | Abnova |
Reference: | H00010841-M01 |
Product name: | FTCD monoclonal antibody (M01), clone 3A4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FTCD. |
Clone: | 3A4 |
Isotype: | IgG2a Kappa |
Gene id: | 10841 |
Gene name: | FTCD |
Gene alias: | LCHC1 |
Gene description: | formiminotransferase cyclodeaminase |
Genbank accession: | NM_206965 |
Immunogen: | FTCD (NP_996848, 440 a.a. ~ 541 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE |
Protein accession: | NP_996848 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to FTCD on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |