Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ALDH1L1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
More info about ALDH1L1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010840-A01 |
| Product name: | ALDH1L1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ALDH1L1. |
| Gene id: | 10840 |
| Gene name: | ALDH1L1 |
| Gene alias: | DKFZp781N0997|FTHFD |
| Gene description: | aldehyde dehydrogenase 1 family, member L1 |
| Genbank accession: | NM_012190 |
| Immunogen: | ALDH1L1 (NP_036322, 803 a.a. ~ 902 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY |
| Protein accession: | NP_036322 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ALDH1L1 polyclonal antibody (A01), Lot # PUM4060503QCS1. Western Blot analysis of ALDH1L1 expression in human liver. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Changes of the hepatic proteome in murine models for toxically induced fibrogenesis and sclerosing cholangitis.Henkel C, Roderfeld M, Weiskirchen R, Berres ML, Hillebrandt S, Lammert F, Meyer HE, Stuhler K, Graf J, Roeb E. Proteomics. 2006 Dec;6(24):6538-48. |