RPP40 MaxPab mouse polyclonal antibody (B01) View larger

RPP40 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPP40 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about RPP40 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00010799-B01
Product name: RPP40 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human RPP40 protein.
Gene id: 10799
Gene name: RPP40
Gene alias: RNASEP1|bA428J1.3
Gene description: ribonuclease P/MRP 40kDa subunit
Genbank accession: BC017871.1
Immunogen: RPP40 (AAH17871.1, 1 a.a. ~ 244 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNTGPYYFVKNLPLHELITPEFISTFIKKGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKK
Protein accession: AAH17871.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010799-B01-13-15-1.jpg
Application image note: Western Blot analysis of RPP40 expression in transfected 293T cell line (H00010799-T01) by RPP40 MaxPab polyclonal antibody.

Lane 1: RPP40 transfected lysate(26.84 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RPP40 MaxPab mouse polyclonal antibody (B01) now

Add to cart