Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NEK6 monoclonal antibody (M02), clone 2A7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about NEK6 monoclonal antibody (M02), clone 2A7
| Brand: | Abnova |
| Reference: | H00010783-M02 |
| Product name: | NEK6 monoclonal antibody (M02), clone 2A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NEK6. |
| Clone: | 2A7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10783 |
| Gene name: | NEK6 |
| Gene alias: | SID6-1512 |
| Gene description: | NIMA (never in mitosis gene a)-related kinase 6 |
| Genbank accession: | BC000101 |
| Immunogen: | NEK6 (AAH00101, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQV |
| Protein accession: | AAH00101 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |