Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ZNF274 monoclonal antibody (M04), clone 1D8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Tr,RNAi-Ab |
More info about ZNF274 monoclonal antibody (M04), clone 1D8
| Brand: | Abnova |
| Reference: | H00010782-M04 |
| Product name: | ZNF274 monoclonal antibody (M04), clone 1D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF274. |
| Clone: | 1D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10782 |
| Gene name: | ZNF274 |
| Gene alias: | DKFZp686K08243|FLJ37843|HFB101|ZF2|ZKSCAN19 |
| Gene description: | zinc finger protein 274 |
| Genbank accession: | NM_133502 |
| Immunogen: | ZNF274 (NP_598009, 420 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT |
| Protein accession: | NP_598009 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of ZNF274 over-expressed 293 cell line, cotransfected with ZNF274 Validated Chimera RNAi ( Cat # H00010782-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF274 monoclonal antibody (M04), clone 1D8 (Cat # H00010782-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | IF,ELISA,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |