Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010782-M01 |
Product name: | ZNF274 monoclonal antibody (M01), clone 4C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF274. |
Clone: | 4C12 |
Isotype: | IgG2b Kappa |
Gene id: | 10782 |
Gene name: | ZNF274 |
Gene alias: | DKFZp686K08243|FLJ37843|HFB101|ZF2|ZKSCAN19 |
Gene description: | zinc finger protein 274 |
Genbank accession: | NM_133502 |
Immunogen: | ZNF274 (NP_598009, 420 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT |
Protein accession: | NP_598009 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.95 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ZNF274 expression in transfected 293T cell line by ZNF274 monoclonal antibody (M01), clone 4C12. Lane 1: ZNF274 transfected lysate(74.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Zinc finger protein 274 regulates imprinted expression of transcripts in Prader-Willi syndrome neurons.Langouet M, Glatt-Deeley HR, Chung MS, Dupont-Thibert CM, Mathieux E, Banda EC, Stoddard CE, Crandall L, Lalande M. Hum Mol Genet. 2018 Feb 1;27(3):505-515 |