ARPP-19 (Human) Recombinant Protein (P01) View larger

ARPP-19 (Human) Recombinant Protein (P01)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARPP-19 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ARPP-19 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00010776-P01
Product name: ARPP-19 (Human) Recombinant Protein (P01)
Product description: Human ARPP-19 full-length ORF ( AAH03418, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 10776
Gene name: ARPP-19
Gene alias: ARPP-16|ARPP16|ARPP19|FLJ41622
Gene description: cyclic AMP phosphoprotein, 19 kD
Genbank accession: BC003418
Immunogen sequence/protein sequence: MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
Protein accession: AAH03418
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00010776-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARPP-19 (Human) Recombinant Protein (P01) now

Add to cart