Brand: | Abnova |
Reference: | H00010772-M07 |
Product name: | FUSIP1 monoclonal antibody (M07), clone 1G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FUSIP1. |
Clone: | 1G11 |
Isotype: | IgG1 Kappa |
Gene id: | 10772 |
Gene name: | FUSIP1 |
Gene alias: | FUSIP2|NSSR|SFRS13|SRp38|SRrp40|TASR|TASR1|TASR2 |
Gene description: | FUS interacting protein (serine/arginine-rich) 1 |
Genbank accession: | BC005039 |
Immunogen: | FUSIP1 (AAH05039, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKE |
Protein accession: | AAH05039 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FUSIP1 monoclonal antibody (M07), clone 1G11. Western Blot analysis of FUSIP1 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |