Brand: | Abnova |
Reference: | H00010769-Q01 |
Product name: | PLK2 (Human) Recombinant Protein (Q01) |
Product description: | Human PLK2 partial ORF ( AAH13879, 585 a.a. - 685 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 10769 |
Gene name: | PLK2 |
Gene alias: | SNK |
Gene description: | polo-like kinase 2 (Drosophila) |
Genbank accession: | BC013879 |
Immunogen sequence/protein sequence: | DGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNMLLQRCN |
Protein accession: | AAH13879 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Design, Synthesis, and Evaluation of Non-ATP-Competitive Small-Molecule Polo-Like Kinase 1 (Plk1) Inhibitors.Chen DX, Huang J, Liu M, Xu YG, Jiang C Arch Pharm (Weinheim). 2014 Nov 27. doi: 10.1002/ardp.201400294. |