TRAF3IP2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

TRAF3IP2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRAF3IP2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about TRAF3IP2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00010758-D01P
Product name: TRAF3IP2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human TRAF3IP2 protein.
Gene id: 10758
Gene name: TRAF3IP2
Gene alias: ACT1|C6orf2|C6orf4|C6orf5|C6orf6|CIKS|DKFZp586G0522|MGC3581
Gene description: TRAF3 interacting protein 2
Genbank accession: NM_147686
Immunogen: TRAF3IP2 (NP_679211.1, 1 a.a. ~ 565 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPNRAGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDTAMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL
Protein accession: NP_679211.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00010758-D01P-2-A7-1.jpg
Application image note: TRAF3IP2 MaxPab rabbit polyclonal antibody. Western Blot analysis of TRAF3IP2 expression in human pancreas.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TRAF3IP2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart