TEBP monoclonal antibody (M01), clone 3H1-2A8 View larger

TEBP monoclonal antibody (M01), clone 3H1-2A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TEBP monoclonal antibody (M01), clone 3H1-2A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about TEBP monoclonal antibody (M01), clone 3H1-2A8

Brand: Abnova
Reference: H00010728-M01
Product name: TEBP monoclonal antibody (M01), clone 3H1-2A8
Product description: Mouse monoclonal antibody raised against a full length recombinant TEBP.
Clone: 3H1-2A8
Isotype: IgG2a kappa
Gene id: 10728
Gene name: PTGES3
Gene alias: P23|TEBP|cPGES
Gene description: prostaglandin E synthase 3 (cytosolic)
Genbank accession: BC003005
Immunogen: TEBP (AAH03005, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Protein accession: AAH03005
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010728-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.34 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010728-M01-1-1-1.jpg
Application image note: TEBP monoclonal antibody (M01), clone 3H1-2A8 Western Blot analysis of TEBP expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TEBP monoclonal antibody (M01), clone 3H1-2A8 now

Add to cart