NUDC monoclonal antibody (M02), clone 6F12 View larger

NUDC monoclonal antibody (M02), clone 6F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUDC monoclonal antibody (M02), clone 6F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about NUDC monoclonal antibody (M02), clone 6F12

Brand: Abnova
Reference: H00010726-M02
Product name: NUDC monoclonal antibody (M02), clone 6F12
Product description: Mouse monoclonal antibody raised against a full-length recombinant NUDC.
Clone: 6F12
Isotype: IgG1 Kappa
Gene id: 10726
Gene name: NUDC
Gene alias: HNUDC|MNUDC|NPD011
Gene description: nuclear distribution gene C homolog (A. nidulans)
Genbank accession: BC002399
Immunogen: NUDC (AAH02399, 1 a.a. ~ 331 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEGEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN
Protein accession: AAH02399
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010726-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (62.15 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010726-M02-13-15-1.jpg
Application image note: Western Blot analysis of NUDC expression in transfected 293T cell line by NUDC monoclonal antibody (M02), clone 6F12.

Lane 1: NUDC transfected lysate(38.2 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NUDC monoclonal antibody (M02), clone 6F12 now

Add to cart