NUDC purified MaxPab mouse polyclonal antibody (B01P) View larger

NUDC purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUDC purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NUDC purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00010726-B01P
Product name: NUDC purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NUDC protein.
Gene id: 10726
Gene name: NUDC
Gene alias: HNUDC|MNUDC|NPD011
Gene description: nuclear distribution gene C homolog (A. nidulans)
Genbank accession: NM_006600.2
Immunogen: NUDC (NP_006591.1, 1 a.a. ~ 331 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN
Protein accession: NP_006591.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010726-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NUDC expression in transfected 293T cell line (H00010726-T01) by NUDC MaxPab polyclonal antibody.

Lane 1: NUDC transfected lysate(36.41 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NUDC purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart