NFAT5 monoclonal antibody (M02), clone 1H16 View larger

NFAT5 monoclonal antibody (M02), clone 1H16

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NFAT5 monoclonal antibody (M02), clone 1H16

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NFAT5 monoclonal antibody (M02), clone 1H16

Brand: Abnova
Reference: H00010725-M02
Product name: NFAT5 monoclonal antibody (M02), clone 1H16
Product description: Mouse monoclonal antibody raised against a partial recombinant NFAT5.
Clone: 1H16
Isotype: IgG2a Kappa
Gene id: 10725
Gene name: NFAT5
Gene alias: KIAA0827|NF-AT5|NFATL1|NFATZ|OREBP|TONEBP
Gene description: nuclear factor of activated T-cells 5, tonicity-responsive
Genbank accession: NM_006599
Immunogen: NFAT5 (NP_006590.1, 1422 a.a. ~ 1531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF
Protein accession: NP_006590.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010725-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010725-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged NFAT5 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NFAT5 monoclonal antibody (M02), clone 1H16 now

Add to cart