MGEA5 monoclonal antibody (M02), clone 1C7 View larger

MGEA5 monoclonal antibody (M02), clone 1C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGEA5 monoclonal antibody (M02), clone 1C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about MGEA5 monoclonal antibody (M02), clone 1C7

Brand: Abnova
Reference: H00010724-M02
Product name: MGEA5 monoclonal antibody (M02), clone 1C7
Product description: Mouse monoclonal antibody raised against a partial recombinant MGEA5.
Clone: 1C7
Isotype: IgG2a Kappa
Gene id: 10724
Gene name: MGEA5
Gene alias: FLJ11229|FLJ23355|KIAA0679|MEA5|NCOAT|OGA
Gene description: meningioma expressed antigen 5 (hyaluronidase)
Genbank accession: NM_012215
Immunogen: MGEA5 (NP_036347, 823 a.a. ~ 916 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SFHEEQEVLPETFLANFPSLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIAKMEGFPKDVVILGRSL
Protein accession: NP_036347
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010724-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010724-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged MGEA5 is 0.3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MGEA5 monoclonal antibody (M02), clone 1C7 now

Add to cart